@` ﾭdQ)#  pp$ ll$ hh$ dS" \\$ XX$ @P$ LL$ H @ 8(  P O(  P O  P O. #  P O&  OTP \!\1 C Pڀ@@ @ Pl ?%% \  L HH  <MMOР iHM4"(B B H4P adMMOР iHM"(B B H4P RMMOР iHM"(B B H4P C$MMOР iHMT#(B B H4P 4MMOР iHM#(B B H4P %MMOР iHM$(B B H4P DMMOР iHMt$(B B H4P 0000 0000@@@@@@ @@m @m |00@4@8@<@@@3DT  @-@0 0@x}-(( 0   R@-(00@S T @D00S 00D@-@PP0- 2p@-M@ /,0<8 40P@`'%($ 0"% 0%R  0%UnPNPz Z c0C0vV`%@TT 01 @ 400$Ѝp @plp@-@$@@-@$@@-@$@@-@$@@-@$@|@-@$|@s@-@$s@jQ 0 P:QQ1121:QQ1101:P@  !P@ !!P!@ #!!P@ !!P#2!-(0- 00 `.XXX0000 R100R XXX@-@M @ 8"0S @ /00@Ѝ-,,F$(0$0 0 0>$( DHL@-0,$0@ -$0 !-DX=@-@$ @-l=p@-hQ0C$HDM$ V.$0H0$ P.010A 0 c 1Q  PH0SV<@sW)@ @@ K"P@P0T0  `.TP 0S@@U$h)8$X"P  .@0<"P0 U DHD Xt| EX-#@-qPM!0P @0<`0@-00! -  0Q0ڌ00 00 Rt0 l@0Sdq# P0 H00  0-`O ЍXDXXwXwX@-h00S=T0P 0cSD@00S40A#00@@w}}D-P0cH3 p <3 838ß 43  M` 3 RQ3 0b02  P Ԣj-00VB44x X-2 |2 tp2 hd2V VPL22 0,2 2 11 1P PXV(((($1  |1 h h"=+ \1 h "PHQ@<0S <(1 $10bP0@ࠁ0S Sp S PQ  {"  I/  0 A/  @ ) ЍYwwwwXXwwXXX X,X4D<EDX~ ~PXwwwX| E0 X0@-d| PPX +@LT@@+T ,0 0  0@X'0w@-@T0 j<0 0@www N-QPP4u``M$ (p,P+p(0@0P0`@ 0 & 00c 0, 00c 0000 '<|0@+@ 0`  ЍDXXwwww}}N-(5$5 QM@e? 55,48 < .$s(,#Ƞ4!Xr"Uʴ!"48<#Xp@D Up@DT"8:#:S "48ڍ<~@-M@#P  `($<4<,4%<  `0@0` 1 $0/"?0 p`0g C1ڍ~p@-MP @| `#<,4<$, `!4%< $`0$,0` 00m C1ڍp<~|000CS556 66606LD"<0?g00(0$0up~~~E~@-M@ #<4(<"4 !<S0S 0S0S d0T \0T<4(<"4< <4(<"4 !<0ۍ~`~d~0@-M  t#<4(<"4t !<S P0S 0S 0S @T(  0S# ۍ0~~~@-M  F#<4(<"4` !<S0S  0S @T( 0@# ۍ~~~0@-M  #<4(<"4h !<S P0S  0S 0S@T " ۍ0~<~D-0M "<4(<"4 !<S 0S 0S0SpW $ <ˍ4<("4/P!\p`  h!"@  "0@0p  "0pۍ~ ~0@-PMd "<4(<"40! !<SE R  0S0S0S R0S 20,$,!$#,b)@Q 0?8c13Q 0?5c1R# `d <4<("4!L d PZ"0 0SP5ۍ0~Edgfff EX0@-x! Q 0hQ00CSSD<X<h<<<8=<40D${1P09P@ 0000P #0000+ P@0 0 JPT 0000S0000@0h~p~XH$E~D~~-x 0 `XF-(("(r0$bRM0 2 ЍF`Q0S1  Ġ8̌#Č"̌,4, ,̠0"$ J: P@ @00y 8ANL00X004&Q>$a$ 90S 1P 0 0R (@ Q  000Ϡ0 5!ЍFiX~\~~XlXXt~~XX X8l E=';p~h~l~X8 0SS RR  !E1!D- |1|a  04  8L!<0D1D!@<004!@0A,q@T +0440{T00(T  R 6$0`V01 .}T)T- 0iC R 0 R00$>E-Ѝ@-,M,  m <d10000,00(0$0$0 @ 0,ЍD>tL-00 P-,,,0 R  L>- 06$$0 0 P0EN-11匱 0s`>0n`p\p@PP*41Z40U 1 0010s0d0P0@`P >0>0@0b@4p0e 0 Z0 00P W00 0Gp 0 W 00=@ 800Q0000 0S0EI,PF- Ppp~W*l4Q ^ ^ 0  0 @0P0 @P+$Q R'38PR[PTR'6nP UR7wP3R'9|PPE~P3A ^ 0 gQQ QPd ^W 0 gQ  0P 0 Q  0P00 R *JA 0  - P"38P[ TP"6nUP7wp2P"9|~XbA\0  10 00R*\ 00R: @ @ !?#?C1 P80PP ` @ ^ 0 gQ:Q FQP@00L`F0 0 S 10PP P @000gQ)000gQ!P' 00P0 @ 0 @ P  000P  00 PETEPD-P@0@` V0S@P`P @0010TP81DSp P` 0R   @p00W@  ,1Rp PP  P 0W0@ T10055: Q$38Q[ TQ$6nUQ7w0Q$9|~\0! 10 00T*\ 00T:  PPEIETN-QpMPЍNB@@ 0S` Z P 00000P 0R0k0 000 0 0 R ` 00 `c0P Q <0P0< 000PF  J$R@ 0PR000R 0 0000#R0000 0000000k0 000 00D2 \   0 J @$R ` 0 V. P+  J 0@$R`PR000R 0 0000#R0000 0000005Q1PPF 000@@T00` @"  J$RR000R00000#R0000000000 kQ0P 0 0 0  000i000 000ЍEQD-PPD* UPP!PpP`G 0 e0C0@C0f S@f  a00 0000000*`000jS0 000 00  @-0p@0`TPP@  R00Q00S  B$RR 00R000#R000000oEp@-`0 @0`>0>0ZC U$0 0Re 0erd @`T 8000c( 0000e0pEIP @00@ 0 CPꌰtl8040(0Q0II@-0@ j0-0S09I0S00I0S00I0@-%pPp p0 @T\ (@^ 00 0000@0It>I0 00I-8  L01 Q 80040 0,0 $0$0 ,00 (04XN-` p@0F8M#8VPL0- R0#03T0S& 0R" Q00P!3\ \@8C\ !0 00CU ! 0P:0 00\ЍL D0R P:000CP\N-0M0C `p0VT P[P [ P*  0J8#8 P0O8CP00  W0#03R030"S 0S( P@_ U0V0 [00S P 00@gT@!  0. P _p `V00 U00SЍP- P P P P  P P @P P T P LHD@<8T0,, V>>>>?8?T?l???p@-`P@T V00U0S P` pP@-@@p@-`VP@ PWT00P0SpT fQpQ0@-@P 0 d0 ? 2cR@@ 0 d0\ ? 2cR@d@d 0 0P  00 00Q@-@ P 40000 0@ 00 00TSIL0 00F-P@ Tp@ T 0Sg PtU@ @T Y  0# 0# 0 0C`D !d""Y  0# 0#  000r@-@ R0 0L!!@q Q0 0A# 00N-PMP`0 0SPPP P R  P@P0DpP Palx̼̼Ȼ000 00 00C00C0 0C000 P7ll@̼l̼@lZP@C00 0pPOP@804 0pPDP@-0P400p9P@"0 4pP0 +0P@pP0 0ZP@0 0R Ѝ0 @0 Sa@QA0@W @S7 @ 0@-@PP0P020Q) QP10QQ1121:QQ1101: P@ P@ !!P!@ c!!P@ !!P#2!" l!-R-+00 0!0 "0 0!0 "0 0!0 "0 0!0 "0 0!0 "0 0!0 "0 0!0 "0 01N^ #^ 0 0 01^ #l -  ( PD-FK3p`Mk3V0cP1N@ TP @D(T  D???R@-`P  \\p P @ \ 00  @\ R `L 000S Br 000S 0S  0S000SR 0S 0S000S  R  000S  00c̰0R @ R-0 0 0c0\  R @ 0S  P0S0@-@P 0R0@P3080S  0SbAq 0S Aq 0SbP0@-P P@0f0-0S R 0S  R0S 0S0S R 0S R0S0@-@PPd0@T 0 R@0  P 0S000 040@-@PT  P00 0P 0S0S0Q 0 A0S Br0 Br Br 0 Br0 Br0 Br0P0B s 0 Br0s 0q Br0lR  0 R\R0S R@-PpP`P@  P@D TPB| @ 0RL|@-00S@ 0xS0t 0D^^ H0 D00L  0L070C70LS1!02:TL-0-S  `-000C S0!00C S0AN-XM|$Ÿ$@ P0I"S`pxx 0  W-0 0pg+  PE  YPE YPEW000  B @0 X0PpD C [ PkUPEU 00PE Q R Y00 Y000!00UPEUPE [K [000K\LX D Q\ LAUPEU 00PEXЍ??F- M0S`@/ %Q$0  0 0CS 00A Sp%p*Q00pW`pg 0.S 00B S *R00\0 lRhR qR0000%0C SS񟗧4\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\H\\\\\\\\\\ T\\\\T\\\\@\\d\\\LpGWpG 0W00pGW0`apG 0W0[P1UP J`WpGW 00pGP 0 R0WpG?W 00pG9wp0 m`,0 i` '%00$ @ %000 R 0C0lQ` hQ0 `S8`C0>@0  0S0i0 Ѝ@--  Ѝ--.  04 Ѝ᠆@-PM0 @\ @@@ 0S00000Ѝ@-P@M  R $0S 0S ( $00ЍP@-P` (  P pp0 pV 0`f 00FS0`@ 0 S8&~PpP0@-@P 0S 0Sx8|  R 0 B0 0  Q000 30 #20S00"0    R 0 B0 0  000  2x2# c0#22cQ00T2 w000 6U 0S0S 0f| 00 0]\g   0S0000 RT 0 B0 0<00 0 RC 0 B0 0800 0 R1 0 B0 0400 0 R 0 B0 000  R 00t0 000100000U 0 00 000l@@@B@@ 0SPp@-`  Rp0S00 00\pQ@ Q0SS Ra\00Q00S0 d0Q0p@P^ 0@P0pp@-80S<00@00CS` ( !ࠑ$0S 8(0P\00P P$P40   <00SppD-`p(@  P@ ( PP0@ <(P($,0080 N-400U *PU*0 R cPU:050p( 5 P \p 0 0  Q| 0 < 0a 4S0!0 <00  0 tx0 4 0p@-`@PT Tx p0" {XTfD@0T`_40 000 c$03pBHD L0R"88S0S 0 R 00@-0 RP0@T"88SN0~SI !DB0@T0?0c1Tl6 0?\0!\ PP  +0@T8%0'BBBCC4CgfffPCXC`ClC=0@-0U  0o MP @000S 0 000 0&600000S S 0}0050@00~004000<00Q, 0000Ѝ0*UUtCD-Q00á?@`p D1Q@@!88S (TP  0/0PSUQ cTP+0?0S#1 @P00 00/000x0PpO00000 P00008xPU CCCC=,D N`DDD-\P@`pS :  %P W@Dp`pBT*T @T00P00S PP D0 0@-PU@ d '0@00PX0 k00P00ą00 000LD N@-,@,0 (00S000MhDM000cS0000cSЍ-0?-&@-@J@@-@J@- 880 ,,0 00 0 (0$0 0 00@-@d00@-@,00SP 0##CP0(MbN-M p8@̒0,$,!$#<Q `e ' h @ <4(<"4X"!<S LX  0pL D L8 @`#D ,LP P A  0Y <4(<"4< R!l@P - <4<("4!<P p  06X0P!4S* D  0("0SQ ,<P  1SP< 4( <"4,<PP0`P<4<("4!lP`U@@P3GXTU tP0ЍlDV'`tDD0@-0@P-0@_ DD0 0 000  0 0 0 10AT@@0 0 00 0 0 0 0 10ATQp@-p0 S`0 S 0SpD@D0 0P! 0 10p AT<<000000 a 0 10BT0  0  $,4<DLT\dlt|U-Boot 1.1.1 (Aug 6 2005 - 09:23:44)%K0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ﾎCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z- IRQs %s FIQs %s Mode %s%s Resetting CPU ... USER_26FIQ_26IRQ_26SVC_26UK4_26UK5_26UK6_26UK7_26UK8_26UK9_26UK10_26UK11_26UK12_26UK13_26UK14_26UK15_26USER_32FIQ_32IRQ_32SVC_32UK4_32UK5_32UK6_32ABT_32UK8_32UK9_32UK10_32UND_32UK12_32UK13_32UK14_32SYS_32pc : [<%08lx>] lr : [<%08lx>] sp : %08lx ip : %08lx fp : %08lx r10: %08lx r9 : %08lx r8 : %08lx r7 : %08lx r6 : %08lx r5 : %08lx r4 : %08lx r3 : %08lx r2 : %08lx r1 : %08lx r0 : %08lx Flags: %c%c%c%coffundefined instruction software interrupt prefetch abort data abort not used fast interrupt request interrupt request baudrate %s U-Boot code: %08lX -> %08lX BSS: -> %08lX RAM Configuration: Bank #%d: %08lx Flash: ipaddrethaddrloadaddrbootfile### ERROR ### Please RESET the board ### ## Warning: gatewayip needed but not set ARP Retry count exceeded; starting again gatewayipnetmaskvlannvlanserverip Abort Bytes transferred = %ld (%lx hex) %lxfilesize%lXfileaddrnetretrynooncebad length %d < %d invalid RARP header len bad %d < %d checksum bad ICMP Host Redirect to *** ERROR: `serverip' not set *** ERROR: `ipaddr' not set *** ERROR: `ethaddr' not set %d.%d.%d.%dnone%dLoad address: 0x%lx Loading: *octettimeoutFile too largeFile has bad magic %lu MB reveived TFTP error: First block is not block 1 (%ld) Starting again done TFTP error: '%s' (%d) Starting again T Retry count exceeded; starting again image.bin*** Warning: no boot file name; using '%s' TFTP from server ; our IP address is ; sending through gateway Filename '%s'. Size is 0x%x Bytes = *** WARNING: %s is too long (%d - max: %d) - truncated Host NameRoot PathNIS Domain NameautoloadNFSBOOTP broadcast %d RARP broadcast %d /*** ERROR: Cannot mount *** ERROR: Cannot umount *** ERROR: File lookup fail *** ERROR: Symlink fail Timeout *** ERROR: Fail allocate memory /nfsroot/%02lX%02lX%02lX%02lX.imgFile transfer via NFS from server Filename '%s/%s'. Load address: 0x%lx Loading: *KS8695 ETHERNET: %02x:%02x bootdelaybootcmdHit any key to stop autoboot: %2d %2d boot > ** Too many args (max. %d) ** ## Command too long! Unknown command '%s' - try 'help' Usage: %s 'bootd' recursion detected ## Error: "%s" not defined verifyBad magic number Bad header crc Bad data crc Bad image type Empty Script ## Executing script at %08lx autoscrautoscr - run script from memory [addr] - run script starting at addr - A valid autoscr header must be present arch_numberenv_tboot_paramsDRAM bank-> start-> sizeethaddr =%c%02X ip_addr = baudrate = %d bps %-12s= 0x%08lX bdinfobdinfo - print Board Info structure ## Starting application at 0x%08lX ... ## Application terminated, rc = 0x%lX gogo - start application at address 'addr' addr [arg ...] - start application at address 'addr' passing 'arg' as arguments resetreset - Perform RESET of the CPU ## Transferring control to NetBSD stage-2 loader (at address %08lx) ... ## Booting image at %08lx ... Bad Magic Number Bad Header Checksum Verifying Checksum ... Bad Data CRC OK Unsupported Architecture 0x%x Standalone ApplicationKernel ImageMulti-File ImageWrong Image Type for %s command XIP %s ... Uncompressing %s ... GUNZIP ERROR - must RESET board to recover Unimplemented compression type %d autostartCan't boot image type %d bootmbootm - boot application image from memory [addr [arg ...]] - boot application image stored in memory passing arguments 'arg ...'; when booting a Linux kernel, 'arg' can be the address of an initrd image bootargsboot - boot default, i.e., run 'bootcmd' bootdbootd - boot default, i.e., run 'bootcmd' ## Checking Image at %08lx ... Bad Magic Number Bad Header Checksum Bad Data CRC iminfoiminfo - print header information for application image addr [addr ...] - print header information for application image starting at address 'addr' in memory; this includes verification of the image contents (magic number, header and payload checksums) Image at %08lX: imlsimls - list all images found in flash - Prints information about all images found at sector boundaries in flash. Image Name: %.*s Image Type: Data Size: %d Bytes = Load Address: %08x Entry Point: %08x Contents: Image %d: %8ld Bytes = Invalid OSNetBSDLinuxVxWorksQNXU-BootRTEMSUnknown OSInvalid CPUAlphaARMIntel x86IA64MIPSMIPS 64 BitPowerPCIBM S390SuperHSPARCSPARC 64 BitM68KMicroblazeUnknown ArchitectureInvalid ImageStandalone ProgramRAMDisk ImageFirmwareScriptUnknown Imagegzip compresseduncompressedbzip2 compressedunknown compression%s %s %s (%s)Error: Bad gzipped data Error: gunzip out of data in header Error: inflateInit2() returned %d Error: inflate() returned %d ## Transferring control to RTEMS (at address %08lx) ... ## Checking Filesystem at 0x%08lX ... -rom1fs-## Found ROMfs filesystem at 0x%08lX size 0x%08lX ## Found CRAMfs filesystem at 0x%08lX size 0x%08lX ## Copying Linux Kernel from 0x%08lX to 0x%08lX... ## Starting Linux Kernel at 0x%08lX ... ## Unknown filesystem type, cannot skip gofskgofsk - copy and start kernel after fileystem fsaddr [kaddr [klen]] - copy kernel after fileystem at address 'fsaddr' to 'kaddr' (of length 'klen') and then jump to it List of available devices: %-8s %08x %c%c%c %s coninfoconinfo - print console devices and informations Un-%sProtect Flash Bank # %ld %sProtect Flash Sectors %d-%d in Bank # %d missing or unknown FLASH type Error: end address not on sector boundary Error: end sector precedes start sector Error: cannot span across banks when they are mapped in reverse order Bank # %ld: Only FLASH Banks # 1 ... # %d supported allErase Flash Bank # %ld Bad sector specification Erase Flash Sectors %d-%d in Bank # %d bankErased %d sectors Error: start and/or end address not on sector boundary %sProtected %d sectors flinfoflinfo - print FLASH memory information - print information for all FLASH memory banks flinfo N - print information for FLASH memory bank # N eraseerase - erase FLASH memory start end - erase FLASH from addr 'start' to addr 'end' erase N:SF[-SL] - erase sectors SF-SL in FLASH bank # N erase bank N - erase FLASH bank # N erase all - erase all FLASH banks protectprotect - enable or disable FLASH write protection on start end - protect FLASH from addr 'start' to addr 'end' protect on N:SF[-SL] - protect sectors SF-SL in FLASH bank # N protect on bank N - protect FLASH bank # N protect on all - protect all FLASH banks protect off start end - make FLASH from addr 'start' to addr 'end' writable protect off N:SF[-SL] - make sectors SF-SL writable in FLASH bank # N protect off bank N - make FLASH bank # N writable protect off all - make all FLASH banks writable -lt<-gt>-eq==-ne!=<>-ge>=-le<=Unknown operator '%s' Invalid data width specifier itestitest - return true/false on integer compare [.b, .w, .l, .s] [*]value1 [*]value2 loads_echo## Ready for S-Record download ... ## S-Record download aborted ## Start Addr = 0x%08lX ## First Load Addr = 0x%08lX ## Last Load Addr = 0x%08lX ## Total Size = 0x%08lX = %ld Bytes ## Switch baudrate to %d bps and press ENTER ... ## Ready for binary (kermit) download to 0x%08lX at %d bps... ## Binary (kermit) download aborted ## Switch baudrate to %d bps and press ESC ... ## Total Size = 0x%08x = %d Bytes %Xloadsloads - load S-Record file over serial line [ off ] - load S-Record file over serial line with offset 'off' loadbloadb - load binary file over serial line (kermit mode) [ off ] [ baud ] - load binary file over serial line with offset 'off' and baudrate 'baud' Total of %ld %s%s were the same %08lx: %08x %04x %02x %cbyte at 0x%08lx (0x%02x) != byte at 0x%08lx (0x%02x) word at 0x%08lx (0x%08lx) != word at 0x%08lx (0x%08lx) halfword at 0x%08lx (0x%04x) != halfword at 0x%08lx (0x%04x) bytehalfwordZero length ??? Copy to Flash... done Base Address: 0x%08lx Pattern %08lX Writing...%12sReading... Mem error @ 0x%08X: found %08lX, expected %08lX ? CRC32 for %08lx ... %08lx ==> %08lx mdmd - memory display [.b, .w, .l] address [# of objects] - memory display mmmm - memory modify (auto-incrementing) [.b, .w, .l] address - memory modify, auto increment address nmnm - memory modify (constant address) [.b, .w, .l] address - memory modify, read and keep address mwmw - memory write (fill) [.b, .w, .l] address value [count] - write memory cpcp - memory copy [.b, .w, .l] source target count - copy memory cmpcmp - memory compare [.b, .w, .l] addr1 addr2 count - compare memory crc32crc32 - checksum calculation address count [addr] - compute CRC32 checksum [save at addr] basebase - print or set address offset - print address offset for memory commands base off - set address offset for memory commands to 'off' looploop - infinite loop on address range [.b, .w, .l] address number_of_objects - loop on a set of addresses mtestmtest - simple RAM test [start [end [pattern]]] - simple RAM read/write test sleepsleep - delay execution for some time N - delay execution for N seconds (N is _decimal_ !!!) bootpbootp - boot image via network using BootP/TFTP protocol [loadAddress] [bootfilename] tftpboottftpboot- boot image via network using TFTP protocol rarpbootrarpboot- boot image via network using RARP/TFTP protocol nfsnfs - boot image via network using NFS protocol [loadAddress] [host ip addr:bootfilename] hostnamerootpathdnsipdomainyesAutomatic boot of image at addr 0x%08lX ... Environment size: %d/%d bytes ** Abort serial#Can't overwrite "%s" stdinstdoutstderrCan't delete "%s" ## Baudrate %d bps not supported ## Error: environment overflow, "%s" deleted setenvprintenvprintenv- print environment variables - print values of all environment variables printenv name ... - print value of environment variable 'name' setenv - set environment variables name value ... - set environment variable 'name' to 'value ...' setenv name - delete environment variable 'name' runrun - run commands in an environment variable var [...] - run the commands in the environment variable(s) 'var' %s versionversion - print monitor version echoecho - echo args to console [args..] - echo args to console; \c suppresses newline Unknown command '%s' - try 'help' without arguments for list of all known commands - No help available. helphelp - print online help [command ...] - show help information (for 'command') 'help' prints online help for the monitor commands. Without arguments, it prints a short usage message for all commands. To get detailed help information for specific commands you can type 'help' with one or more command names as arguments. ?? - alias for 'help' In: No input devices available! %s Out: No output devices available! Err: No error devices available! serialCannot initialize the list of devices! Using default environment Timeout writing to Flash Flash not Erased Can't write to protected Flash sectors Outside available Flash Start and/or end address not on sector boundary Unknown Vendor of Flash Unknown Type of Flash General Flash Programming Error flash.c%s[%d] FIXME: rc=%d %2ld.%ld %cB%s0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789abcdefghijklmnopqrstuvwxyzfile errorstream errordata errorinsufficient memorybuffer errorunknown compression methodinvalid window sizeinvalid reserved bitincorrect header checkincorrect data checkinvalid stored block lengthsinvalid block typetoo many length or distance symbolsinvalid bit length repeatoversubscribed dynamic bit lengths treeincomplete dynamic bit lengths treeoversubscribed literal/length treeincomplete literal/length treeinvalid literal/length codeinvalid distance code0.95Pstream end### Entering network recovery mode... console=ttyAM0,115200 mem=48M initrd=0x400000,8M root=/dev/ram0bootp 0x400000; gofsk 0x400000configured too many flash banks! INTEL Unknown Vendor 28F128J3A Unknown Chip Type Size: %ld MB in %d Sectors Sector Start Addresses: (RO) %08lX%s ** ERROR: sector count %d > max (%d) ** - missing - no sectors to erase Can't erase unknown flash type %08lx - aborted - Warning: %d protected sectors will not be erased! Erasing sector %2d ... done not erased at %08lx (%lx) %c## Loading Ramdisk Image at %08lx ... No Linux ARM Ramdisk Image Starting kernel ...  < P    ,,,,,,,,,,,,,@889EEEEEEEEEEEEEEEEEEEEEEEEFFFFFFFF F F(F(F0F0F8F8F@F@FHFHFPFPFXFXF`F`FhFhFpFpFxFxFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFGGGGGGGG G G(G(G0G0G8G8G@G@GHGHGPGPGXGXG`G`GhGhGpGpGxGxGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGHHHHHHHH H H(H(H0H0H8H8H@H@HHHHHPHPHXHXH`H`HhHhHpHpHxHxHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHIIIIIIII I I(I(I0I0I8I8I@I@IHIHIPIPIXIXI`I`IhIhIpIpIxIxIIIIIIIIIbootargs=mem=48M console=ttyAM0,115200bootcmd=gofsk 0x03200000bootdelay=0baudrate=115200??      #+3;CScs !1Aa  0@` B$Bl @,@<@H@\@l(((((AAAAAABBBBBB\/-OO8P<l4pQ7W WW PY !%@`%%&b&l(f( )|)f))l*it**-